.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cw9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the human Tim44 C-terminal domain in complex with pentaethylene glycol: ligand-bound form. Acta Crystallogr.,Sect.D 63 1225-1234 2007
    Site RSGI
    PDB Id 2cw9 Target Id hss001002567.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13298, Molecular Weight 21113.07 Da.
    Residues 187 Isoelectric Point 4.49
    Sequence desdnafirasraltdkvtdllgglfsktemsevlteilrvdpafdkdrflkqcendiipnvleamisg eldilkdwcyeatysqlahpiqqakalglqfhsrildidnvdlamgkmveqgpvliitfqaqlvmvvrn pkgevvegdpdkvlrmlyvwalcrdqdelnpyaawrlldisassteqil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.221
    Matthews' coefficent 4.20 Rfactor 0.218
    Waters 151 Solvent Content 70.60

    Ligand Information
    Ligands 1PE (PENTAETHYLENE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch