The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ADP-ribosylglycohydrolase-related protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cwc Target Id ttk003001307.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14680, Molecular Weight 32910.62 Da.
    Residues 303 Isoelectric Point 6.35
    Sequence mkglkerqdrrlgaflglavgdalgaqveglpkgtfpevremkgggphrlppgfwtddtsqalclaesl lqrgfdpkdqmdrylrwyregyrsatgvcfglghatrraleryaatgdpyagdeagagngplmrlaplv layenhpdllslarraartthgarealeatevlawllrealrgapkeallalepfrgadlhpalrrvve ggfweapeegpgyapgtlaaalwafargrdfeegmrlavnlggdadtvgavygqlagayyglgaipgrw lralhlreemealalalyrmsmaspre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.214
    Matthews' coefficent 2.00 Rfactor 0.193
    Waters 220 Solvent Content 36.80

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch