.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cwd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of TT1001 protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cwd Target Id ttk003001001.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14505, Molecular Weight 18438.99 Da.
    Residues 161 Isoelectric Point 5.33
    Sequence mdrpvrvlfvclgnicrspmaegifrkllkergledrfevdsagtgawhvgepmdprarrvleeegayf phvarrltredvlaydhilvmdrenleevlrrfpeargkvrlvleelgggevqdpyygdledfrkvywt leaalqafldrhgspspaaegra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.253
    Matthews' coefficent 2.10 Rfactor 0.227
    Waters 398 Solvent Content 41.90

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch