.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cwe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical transcriptional regulator protein, PH1932 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2cwe Target Id pho001001932.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14022, Molecular Weight 22760.30 Da.
    Residues 192 Isoelectric Point 7.80
    Sequence makkvkvitdpevikvmledtrrkilkllrnkemtisqlseilgktpqtiyhhieklkeaglvevkrte mkgnlvekyygrtadvfyinlylgdeelryiarsrlktkidifkrlgyqfeenellnimdrmsqkefda tvriskyieekedalkdfsnediihaiewlstaelardeeylellkrlgsilkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.29
    Matthews' coefficent 2.30 Rfactor 0.211
    Waters 32 Solvent Content 45.90

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch