The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title crystal structure of APE1501, a putative endonuclease from Aeropyrum pernix. To be Published
    Site RSGI
    PDB Id 2cwj Target Id ape001001501.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12106, Molecular Weight 13470.67 Da.
    Residues 123 Isoelectric Point 5.01
    Sequence metapkpvgpysqavesgcfmfvsgqipinpetgaleeggfkesakraldnlkaivegagysmddivkv tvyitdisrfsefnevyreyfnrpyparavvgvaalplgapleveavlytcrrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.60 Rfree 0.337
    Matthews' coefficent 4.00 Rfactor 0.326
    Waters Solvent Content 69.26

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch