.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cwl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and functional analysis of pseudocatalase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cwl Target Id ttk003001342.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14691, Molecular Weight 33331.41 Da.
    Residues 302 Isoelectric Point 5.43
    Sequence mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyydlianiate elghielvaatinsllaknpgkdleegvdpesaplgfakdvrnaahfiagganslvmgamgehwngeyv ftsgnlildllhnfflevaarthklrvyemtdnpvaremigyllvrggvhaaaygkalesltgvemtkm lpipkidnskipeakkymdlgfhrnlyrfspedyrdlgliwkgaspedgtevvvvdgpptggpvfdagh daaefapefhpgelyeiakklyekak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.181
    Matthews' coefficent 2.80 Rfactor 0.166
    Waters 442 Solvent Content 56.20

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch