The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mouse transaldolase. To be Published
    Site RSGI
    PDB Id 2cwn Target Id mmt007100385.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13592, Molecular Weight 35783.02 Da.
    Residues 324 Isoelectric Point 5.86
    Sequence saldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygkklggpqeeqik naidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielykeagvgkdriliklsstwegi qagkeleeqhgihcnmtllfsfaqavacaeagvtlispfvgrildwhvantdkksyepqgdpgvksvtk iynyykkfgyktivmgasfrntgeikalagcdfltispkllgellkdnsnlapalsvkaaqtsdsekih ldekafrwlhnedqmaveklsdgirkfaadaiklermltermfsaeng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.239
    Matthews' coefficent 2.20 Rfactor 0.196
    Waters 364 Solvent Content 44.40

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch