The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MetRS related protein from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2cwp Target Id pho001000285.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13809, Molecular Weight 12886.61 Da.
    Residues 112 Isoelectric Point 6.35
    Sequence mnymelydvdefwkfqmkvglvkkaekikrtkkliklivdfgneertivtgiadqippeelegkkfifv vnlkpkkfsgvesqgmlilaetedgkvylipvpeevpvgarvw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.276
    Matthews' coefficent 2.14 Rfactor 0.214
    Waters 47 Solvent Content 42.58

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch