The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of a putative RNA 5-methyluridine methyltransferase, Thermus thermophilus TTHA1280, and its complex with S-adenosyl-L-homocysteine. Acta Crystallogr.,Sect.F 61 867-874 2005
    Site RSGI
    PDB Id 2cww Target Id ttk003001595.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14754, Molecular Weight 42945.04 Da.
    Residues 382 Isoelectric Point 9.01
    Sequence mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavrayrfapaedpv aallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdxyaghavvqatahawegllpqvaealr phvqsvlakndartreleglplyvrpllgevpervqvqegrvrylvdlragqktgayldqrenrlymer frgeraldvfsyaggfalhlalgfrevvavdssaealrraeenarlnglgnvrvleanafdllrrleke gerfdlvvldppafakgkkdverayraykevnlraikllkeggilatascshhmteplfyamvaeaaqd ahrllrvvekrgqpfdhpvllnhpethylkfavfqvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.297
    Matthews' coefficent 2.34 Rfactor 0.258
    Waters 32 Solvent Content 47.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch