.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cwx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-1 crystal). To be Published
    Site RSGI
    PDB Id 2cwx Target Id pho001000939.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13950, Molecular Weight 48244.20 Da.
    Residues 430 Isoelectric Point 6.35
    Sequence mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrsm akvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppyeylrhfkgpqf gvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkddenftsfpfnrfeervrkly rvrdrveaetgetkeylinitgpvnimekraemvaneggqyvmidivvagwsalqymrevtedlglaih ahramhaaftrnprhgitmlalakaarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfp vasgglhpglmpelirlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkk slrevglskakvgvqh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.21018
    Matthews' coefficent 2.85 Rfactor 0.17624
    Waters 469 Solvent Content 56.82

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch