.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cx3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-1 crystal). To be Published
    Site RSGI
    PDB Id 2cx3 Target Id ape001002125.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12114, Molecular Weight 18669.64 Da.
    Residues 164 Isoelectric Point 5.57
    Sequence mkglvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaqlekanae vlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakravfivkpdgtvaykwv tdnplnepdydevvreankiagelva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.64 Rfree 0.247
    Matthews' coefficent 3.27 Rfactor 0.206
    Waters 200 Solvent Content 61.70

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch