.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cx9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of acyl-CoA dehydrogenase. To be Published
    Site RSGI
    PDB Id 2cx9 Target Id ttk003000172.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14260, Molecular Weight 41529.15 Da.
    Residues 387 Isoelectric Point 5.60
    Sequence mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeayggaglstr lfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgealgawgltepgsgsdaaa lktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsperkhqgisafaffrperglkvgrkeek lgltasdtaqliledlfvpeeallgergkgfydvlrvldggrigiaamavglgqaaldyalayakgrea fgrpiaefegvsfklaeaateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilg gygyvkdypverywrdarltrigegtseilklviarrlleav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.272
    Matthews' coefficent 2.41 Rfactor 0.237
    Waters 499 Solvent Content 48.96

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch