.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cxi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and mutational studies of the amino acid-editing domain from archaeal/eukaryal phenylalanyl-tRNA synthetase. Proc.Natl.Acad.Sci.Usa 103 14744-14749 2006
    Site RSGI
    PDB Id 2cxi Target Id pho001000657.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13846, Molecular Weight 64191.42 Da.
    Residues 556 Isoelectric Point 5.04
    Sequence mpkfdvsksdlerligrsfsieewedlvlyakcelddvweengkvyfkldskdtnrpdlwsaegvarqi kwalgiekglpkyevkksnvtvyvdeklkdirpygvyaiveglrldedslsqmiqlqekialtfgrrrr evaigifdfdkikppiyykaaektekfaplgykeemtleeilekhekgreyghlikdkqfypllidseg nvlsmppiinseftgrvttdtknvfidvtgwklekvmlalnvmvtalaerggkirsvrvvykdfeietp dltpkefeveldyirklsglelndgeikellekmmyeveisrgraklkypafrddimhardiledvlia ygynniepeepklavqgrgdpfkdfedairdlmvgfglqevmtfnltnkevqfkkmnipeeeiveianp isqrwsalrkwilpslmeflsnntheeypqrifevglatlidesretktvsepklavalagtgytftna keildalmrhlgfeyeieevehgsfipgragkiivngrdigiigevhpqvlenwnievpvvafeiflrplyrh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.94 Rfree 0.2307
    Matthews' coefficent 2.96 Rfactor 0.18766
    Waters 684 Solvent Content 58.43

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch