.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cxk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the TIG domain of human calmodulin-binding transcription activator 1 (CAMTA1). To be Published
    Site RSGI
    PDB Id 2cxk Target Id hsk002200815.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12792, Molecular Weight 9100.84 Da.
    Residues 82 Isoelectric Point 4.43
    Sequence mvtdyspewsypeggvkvlitgpwqeasnnysclfdqisvpasliqpgvlrcycpahdtglvtlqvafn nqiisnsvvfeyk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 1.85 Rfree 0.259
    Matthews' coefficent 2.28 Rfactor 0.226
    Waters 316 Solvent Content 41.21

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch