.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cxl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x. J.Biol.Chem. 281 31843-31853 2006
    Site RSGI
    PDB Id 2cxl Target Id mmk001003772.3
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13444, Molecular Weight 20384.90 Da.
    Residues 183 Isoelectric Point 6.17
    Sequence manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflgqnksfwgpl elveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkellsefyevnalmme eegaiiagllvglnvidanfcmkgedldsqvgvidfsmylkdgns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.20 Rfree 0.36
    Matthews' coefficent 2.91 Rfactor 0.28
    Waters Solvent Content 57.70

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch