The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hBAF250b AT-rich interaction domain (ARID). To be Published
    Site RSGI
    PDB Id 2cxy Target Id hsk002001209.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12638, Molecular Weight 13388.66 Da.
    Residues 118 Isoelectric Point 8.56
    Sequence ekitkvyelgneperklwvdryltfmeergspvsslpavgkkpldlfrlyvcvkeigglaqvnknkkwr elatnlnvgtsssaasslkkqyiqylfafeckiergeepppevfstgdt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.203
    Matthews' coefficent 2.27 Rfactor 0.185
    Waters 119 Solvent Content 46.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch