The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-1 crystal). To be Published
    Site RSGI
    PDB Id 2cy4 Target Id mmt007011014.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13524, Molecular Weight 15675.01 Da.
    Residues 140 Isoelectric Point 5.03
    Sequence stvvmadvsqyhvnhlvtfclgeedgvhtvedasrklavmdsqgrvwaqemllrvspsqvtlldpvske elesypldaivrcdavmprgrsrsllllvcqeperaqpdvhffqglllgaelirediqgalqnyrsgrg er
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.94 Rfree 0.238
    Matthews' coefficent 3.16 Rfactor 0.209
    Waters 73 Solvent Content 60.30

    Ligand Information
    Metals CA (CALCIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch