.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cyb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Tyrosyl-tRNA Synthetases from Archaea. J.Mol.Biol. 355 395-408 2006
    Site RSGI
    PDB Id 2cyb Target Id my_001000007.1
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS13667, Molecular Weight 36614.40 Da.
    Residues 323 Isoelectric Point 5.63
    Sequence mditeklrlitrnaeevvteeelrqlietkekprayvgyepsgeihlghmmtvqklmdlqeagfeiivl ladihaylnekgtfeeiaevadynkkvfialgldesrakfvlgseyqlsrdyvldvlkmarittlnrar rsmdevsrrkedpmvsqmiyplmqaldiahlgvdlavggidqrkihmlarenlprlgysspvclhtpil vgldgqkmssskgnyisvrdppeeverkirkaycpagvveenpildiakyhilprfgkivverdakfgg dveyasfeelaedfksgqlhpldlkiavakylnmlledarkrlgvsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.24
    Matthews' coefficent 2.57 Rfactor 0.202
    Waters 314 Solvent Content 52.00

    Ligand Information
    Ligands TYR x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch