The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Tyrosyl-tRNA Synthetases from Archaea. J.Mol.Biol. 355 395-408 2006
    Site RSGI
    PDB Id 2cyc Target Id pho001001011.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13963, Molecular Weight 43274.20 Da.
    Residues 375 Isoelectric Point 6.45
    Sequence mdieerinlvlkkpteevltvenlrhlfeigaplqhyigfeisgyihlgtglmagakiadfqkagiktr vfladwhswindklggdleviqevalkyfkvgmeksievmggdpkkvefvlaseilekgdywqtvidis knvtlsrvmrsitimgrqmgeaidfakliypmmqvadifyqgvtiahagmdqrkahviaievaqklryh pivhegeklkpvavhhhlllglqeppkwpieseeefkeikaqmkmskskpysavfihdspeeirqklrk afcparevrynpvldwveyiifreepteftvhrpakfggdvtyttfeelkrdfaegklhpldlknavae ylinllepirryfekhpeplelmrsvkitr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.217
    Matthews' coefficent 3.26 Rfactor 0.171
    Waters 636 Solvent Content 62.30

    Ligand Information
    Ligands TYR x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch