.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cye

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the putative thioesterase protein TTHA1846 from Thermus thermophilus HB8 complexed with coenzyme A and a zinc ion. Acta Crystallogr.,Sect.D 65 767-776 2009
    Site RSGI
    PDB Id 2cye Target Id ttk003001811.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14798, Molecular Weight 15063.70 Da.
    Residues 133 Isoelectric Point 6.85
    Sequence megfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmevdylrpillg devfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpeaireriralegrpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.242
    Matthews' coefficent 2.05 Rfactor 0.208
    Waters 296 Solvent Content 39.95

    Ligand Information
    Ligands COA (COENZYME) x 4
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch