.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cyx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of human ubiquitin-conjugating enzyme E2 G2 (UBE2G2/UBC7). Acta Crystallogr.,Sect.F 62 330-334 2006
    Site RSGI
    PDB Id 2cyx Target Id ar_001000136.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12125, Molecular Weight 18627.48 Da.
    Residues 165 Isoelectric Point 4.86
    Sequence magtalkrlmavykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsfpldyplspp kmrftcemfhpniypdgrvcisilhapgddphglreqperwspvqsvekillsvvsmlaepndesganv daskmwrddreqfykiakqivqkslgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.56 Rfree 0.262
    Matthews' coefficent 3.83 Rfactor 0.228
    Waters 23 Solvent Content 67.91

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch