The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH1519 from Pyrococcus horikosii OT3. To be Published
    Site RSGI
    PDB Id 2cyy Target Id pho001001519.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13995, Molecular Weight 16952.93 Da.
    Residues 151 Isoelectric Point 7.87
    Sequence mrvpldeidkkiikilqndgkaplreiskitglaestiherirklresgvikkftaiidpealgysmla filvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldligsipgvegthtmiv lkthkettelpik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.245
    Matthews' coefficent 3.42 Rfactor 0.219
    Waters 214 Solvent Content 64.02

    Ligand Information
    Ligands GLN x 1
    Metals CA (CALCIUM) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch