The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title photo-activation state of Fe-type NHase with n-BA in anaerobic condition. To be Published
    Site RSGI
    PDB Id 2cz1 Target Id ar_001000506.6
    Molecular Characteristics
    Source Rhodococcus erythropolis
    Alias Ids TPS12180, Molecular Weight 24328.34 Da.
    Residues 219 Isoelectric Point 5.00
    Sequence svtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtprrg aelvarawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglppt wyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqeivtkdc ligvaipqvptv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.39 Rfree 0.1904
    Matthews' coefficent 2.54 Rfactor 0.163
    Waters 553 Solvent Content 51.48

    Ligand Information
    Ligands BUA (BUTANOIC) x 1
    Metals MG (MAGNESIUM) x 1;FE (FE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch