The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative PII-like signaling protein (TTHA0516) from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cz4 Target Id ttk003001772.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14792, Molecular Weight 11483.74 Da.
    Residues 100 Isoelectric Point 5.87
    Sequence mdlvplklvtivaesllekrlveevkrlgakgytitpargegsrgirsvdwegqnirletivseevalr ilqrlqeeyfphyaviayvenvwvvrgekyv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.93 Rfree 0.227
    Matthews' coefficent 2.50 Rfactor 0.192
    Waters 178 Solvent Content 50.80

    Ligand Information
    Ligands ACT (ACETATE) x 4
    Metals CL (CHLORIDE) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch