.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cz6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title x-ray snap shots of inhibitor binding process in photo-reactive nitrile hydratase. To be Published
    Site RSGI
    PDB Id 2cz6 Target Id ar_001000506.2
    Molecular Characteristics
    Source Rhodococcus erythropolis
    Alias Ids TPS12176, Molecular Weight 24328.34 Da.
    Residues 219 Isoelectric Point 5.00
    Sequence svtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtprrg aelvarawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglppt wyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqeivtkdc ligvaipqvptv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.157
    Matthews' coefficent 2.50 Rfactor 0.153
    Waters 778 Solvent Content 49.60

    Ligand Information
    Ligands _NO (NITRIC) x 1;CYI (CYCLOHEXYL) x 1
    Metals FE (FE) x 1;MG (MAGNESIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch