.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cz9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of galactokinase from Pyrococcus horikoshi. To be Published
    Site RSGI
    PDB Id 2cz9 Target Id pho001000369.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13815, Molecular Weight 39339.98 Da.
    Residues 350 Isoelectric Point 5.76
    Sequence mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslndlrkenswid yvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldklynlkldslskvllakkaen efvgvpcgildqfavvfgregnvifldthtldyeyipfpkdvsilvfytgvrrelasseyaerkhiaee slkilgkgsskevregelsklpplhrkffgyivrenarvlevrdalkegnveevgkilttahwdlakny evsckeldffveralklgaygarltgagfggsaialvdkedaetigeeilreylkrfpwkarhfiveps dgvgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.224
    Matthews' coefficent 2.00 Rfactor 0.209
    Waters 319 Solvent Content 39.20

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch