.
The Open Protein Structure Annotation Network
PDB Keyword
.

2czc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2czc Target Id pho001001830.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14013, Molecular Weight 37261.90 Da.
    Residues 334 Isoelectric Point 5.97
    Sequence mkvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefiprfekegfev agtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevsfvaqanyeaalgknyvrv vscnttglvrtlsaireyadyvyavmirraadpndtkrgpinaikptvevpshhgpdvqtvipinietm afvvpttlmhvhsvmvelkkpltkddvidifenttrvllfekekgfdstaqiiefardlhrewnnlyei avwkesinikgnrlfyiqavhqesdvipenidairamfeladkwdsikktnkslgilk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.241
    Matthews' coefficent 2.33 Rfactor 0.205
    Waters 478 Solvent Content 47.24

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 5;NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch