.
The Open Protein Structure Annotation Network
PDB Keyword
.

2czf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 complexed with XMP. To be Published
    Site RSGI
    PDB Id 2czf Target Id pho001000731.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13941, Molecular Weight 26203.83 Da.
    Residues 241 Isoelectric Point 7.77
    Sequence mgrnpsespqecnsrglypkergdnarntgggqvivlaldvyegeraikiaksvkdyismikvnwplil gsgvdiirrlkeetgveiiadlkladipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimv vemshpgalefinpltdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakda vkagadyiivgraiynapnpreaakaiydeirgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.242
    Matthews' coefficent 2.16 Rfactor 0.208
    Waters 165 Solvent Content 43.08

    Ligand Information
    Ligands XMP (XANTHOSINE-5'-MONOPHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch