The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures. Proteins 67 732-742 2007
    Site RSGI
    PDB Id 2czi Target Id ar_001000354.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12146, Molecular Weight 31319.09 Da.
    Residues 288 Isoelectric Point 6.15
    Sequence mkpsgedqaalaagpweecfqaavqlalragqiirkalteekrvstktsaadlvtetdhlvedliisel rerfpshrfiaeeaaasgakcvlthsptwiidpidgtcnfvhrfptvavsigfavrqelefgviyhcte erlytgrrgrgafcngqrlrvsgetdlskalvlteigpkrdpatlklflsnmerllhakahgvrvigss tlalchlasgaadayyqfglhcwdlaaatviireaggividtsggpldlmacrvvaastremamliaqa lqtinygrddek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.286
    Matthews' coefficent 2.76 Rfactor 0.25
    Waters 7 Solvent Content 55.44

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals CA (CALCIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch