The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of the catalytic mechanism operating in open-closed conformers of lipocalin type prostaglandin D synthase. J.Biol.Chem. 284 22344-22352 2009
    Site RSGI
    PDB Id 2czt Target Id my_001000145.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13749, Molecular Weight 18594.95 Da.
    Residues 167 Isoelectric Point 7.93
    Sequence gsqghdtvqpnfqqdkflgrwysaglasnsswfrekkavlymaktvvapstegglnltstflrknqcet kimvlqpagapghytyssphsgsihsvsvveanydeyallfsrgtkgpgqdfrmatlysrtqtlkdelk ekfttfskaqglteedivflpqpdkciqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.278
    Matthews' coefficent 2.20 Rfactor 0.242
    Waters 32 Solvent Content 44.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch