The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human indoleamine 2,3-dioxygenase: catalytic mechanism of O2 incorporation by a heme-containing dioxygenase. Proc.Natl.Acad.Sci.Usa 103 2611-2616 2006
    Site RSGI
    PDB Id 2d0u Target Id my_001000021.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13687, Molecular Weight 45323.88 Da.
    Residues 403 Isoelectric Point 6.87
    Sequence mahamenswtiskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidh ltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvlanwkkkd pnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerdtllkalleiascl ekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwedpkefaggsagqssvfqcfdvl lgiqqtaggghaaqflqdmrrymppahrnflcslesnpsvrefvlskgdaglreaydacvkalvslrsy hlqivtkyilipasqqpkenktsedpskleakgtggtdlmnflktvrstteksllkeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.40 Rfree 0.254
    Matthews' coefficent 3.00 Rfactor 0.213
    Waters Solvent Content 59.30

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch