.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d13

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PH1257 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2d13 Target Id pho001001257.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13979, Molecular Weight 25772.48 Da.
    Residues 227 Isoelectric Point 6.04
    Sequence mvgladvavlysggkdsnyalywalksglrvrylvsmvseneesymyhtpnveltslqaralgipiikg ftkgekekevedlknvleglkvdgivagalasryqkerienvarelglkvytpawekdpyqymleiikl gfkvvfvavsayglneswlgrelnyknleelkklsekygihiageggefetfvldmpffkakividdae kfwdglsgkfiikrahlewk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.25
    Matthews' coefficent 2.20 Rfactor 0.229
    Waters 213 Solvent Content 44.30

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch