.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d16

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PH1918 protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2d16 Target Id pho001001918.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14021, Molecular Weight 17640.54 Da.
    Residues 162 Isoelectric Point 5.51
    Sequence mvrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltrytgndpeleal aaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqvivaetelgravigvvdgkaa nkietdeqkkerrelvekigykid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.65 Rfree 0.204
    Matthews' coefficent 2.30 Rfactor 0.185
    Waters 596 Solvent Content 44.90

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals NA (SODIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch