.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d1h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The putative DNA-binding protein Sto12a from the thermoacidophilic archaeon Sulfolobus tokodaii contains intrachain and interchain disulfide bonds. J.Mol.Biol. 372 1293-1304 2007
    Site RSGI
    PDB Id 2d1h Target Id sto001001889.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14059, Molecular Weight 12529.17 Da.
    Residues 109 Isoelectric Point 9.10
    Sequence mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkklielglvvrt ktegkkigrpkyyysissnilekirndllncakrmelaat
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.272
    Matthews' coefficent 2.40 Rfactor 0.237
    Waters 90 Solvent Content 48.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch