The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the spectral difference in luciferase bioluminescence. Nature 440 372-376 2006
    Site RSGI
    PDB Id 2d1q Target Id my_001000084.1
    Molecular Characteristics
    Source Luciola cruciata
    Alias Ids TPS13738, Molecular Weight 60014.16 Da.
    Residues 548 Isoelectric Point 7.07
    Sequence menmendenivvgpkpfypieegsagtqlrkymeryaklgaiaftnavtgvdysyaeylekscclgkal qnyglvvdgrialcsenceeffipviaglfigvgvaptneiytlrelvhslgiskptivfsskkgldkv itvqktvttiktivildskvdyrgyqcldtfikrntppgfqassfktvevdrkeqvalimnssgstglp kgvqlthentvtrfshardpiygnqvspgtavltvvpfhhgfgmfttlgylicgfrvvmltkfdeetfl ktlqdykctsvilvptlfailnksellnkydlsnlveiasggaplskevgeavarrfnlpgvrqgyglt ettsaiiitpegddkpgasgkvvplfkakvidldtkkslgpnrrgevcvkgpmlmkgyvnnpeatkeli deegwlhtgdigyydeekhffivdrlkslikykgyqvppaelesvllqhpsifdagvagvpdpvagelp gavvvlesgknmtekevmdyvasqvsnakrlrggvrfvdevpkgltgkidgraireilkkpvakm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.22766
    Matthews' coefficent 2.35 Rfactor 0.17898
    Waters 183 Solvent Content 47.20

    Ligand Information
    Ligands AMP (ADENOSINE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch