.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d29

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study on project ID TT0172 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2d29 Target Id ttk003000172.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14261, Molecular Weight 41521.23 Da.
    Residues 387 Isoelectric Point 5.60
    Sequence mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeayggaglstr lfarmveaiayydgalaltvashxslatghillagseaqkeaflpklasgealgawgltepgsgsdaaa lktkaekveggwrlxgtkqfitqgsvagvyvvmartdpppsperkhqgisafaffrperglkvgrkeek lgltasdtaqliledlfvpeeallgergkgfydvlrvldggrigiaamavglgqaaldyalayakgrea fgrpiaefegvsfklaeaateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilg gygyvkdypverywrdarltrigegtseilklviarrlleav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.204
    Matthews' coefficent 2.40 Rfactor 0.185
    Waters 832 Solvent Content 48.50

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch