The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Atypical Cytoplasmic ABC-ATPase SufC from Thermus thermophilus HB8. J.Mol.Biol. 353 1043-1054 2005
    Site RSGI
    PDB Id 2d2f Target Id ttk003001358.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14703, Molecular Weight 27572.30 Da.
    Residues 250 Isoelectric Point 5.04
    Sequence msqleirdlwasidgetilkgvnlvvpkgevhalmgpngagkstlgkilagdpeytvergeilldgeni lelspderarkglflafqypvevpgvtianflrlalqaklgrevgvaefwtkvkkalelldwdesylsr ylnegfsggekkrneilqllvleptyavldetdsgldidalkvvargvnamrgpnfgalvithyqriln yiqpdkvhvmmdgrvvatggpelaleleakgyewlkekvkega
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.219
    Matthews' coefficent 2.08 Rfactor 0.182
    Waters 184 Solvent Content 40.82

    Ligand Information
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch