.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d3k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of peptidyl-tRNA hydrolase 2 from Pyrococcus horikoshii OT3: insight into the functional role of its dimeric state. Acta Crystallogr.,Sect.D 64 444-453 2008
    Site RSGI
    PDB Id 2d3k Target Id pho001001539.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13997, Molecular Weight 13376.12 Da.
    Residues 121 Isoelectric Point 9.43
    Sequence mikmfkykqvivaradlklskgklaaqvahgavtaafeaykkkrewfeawfregqkkvvvkveseeelf klkaeaeklglpnalirdaglteippgtvtvlavgpapeeivdkvtgnlkll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.255
    Matthews' coefficent 2.10 Rfactor 0.208
    Waters 244 Solvent Content 42.30

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch