The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the HpcC from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2d4e Target Id ttk003000366.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14350, Molecular Weight 57197.37 Da.
    Residues 515 Isoelectric Point 6.22
    Sequence mryadrvagiswetieevrrrlkerpalhfiagefvpsesgetfpsldpatnevlgvaarggerevdra akaaheafqrwsrtkakerkryllriaeliekhadelavmecldagqvlrivraqvaraaenfafyaey aehamedrtfpvdrdwlyytvrvpagpvgiitpwnaplmlstwriapalafgntvvlkpaewspftatk laeilkeadlppgvfnlvqgfgeeagaalvahplvplltltgetetgkivmrnaadhlkrlspelggks palvfadadleraldavvfqifsfngerctassrllveekifedfvgkvverarairvghpldpetevg plihpehlqrvlgyveagkregarllvggeraktsfrgedlsrgnyllptvfvgenhmkiaqeeifgpv lvaipfkdeeealrkandtkyglaayvftrdlerahrlaleleagmvylnshnvrhlptpfggvkgsgd rreggtyaldfytdlktialplrpphvpkfgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.212
    Matthews' coefficent 3.10 Rfactor 0.179
    Waters 1569 Solvent Content 60.38

    Ligand Information
    Metals NA (SODIUM) x 6



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch