.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d59

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of CoA recognition by the Pyrococcus single-domain CoA-binding proteins. J.STRUCT.FUNCT.GENOM. 7 119-129 2006
    Site RSGI
    PDB Id 2d59 Target Id pho001001109.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13973, Molecular Weight 16720.56 Da.
    Residues 144 Isoelectric Point 6.18
    Sequence meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkyeevlgrkcyp svldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskkadeagliivanrcmmrehe rllgek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.239
    Matthews' coefficent 2.02 Rfactor 0.212
    Waters 123 Solvent Content 39.02

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch