.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d5b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Y225F/A Mutation for Met-tRNA synthetase reveals importance of hydrophobic circumstances. To be Published
    Site RSGI
    PDB Id 2d5b Target Id ttk003000875.5
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14468, Molecular Weight 70689.73 Da.
    Residues 618 Isoelectric Point 6.04
    Sequence mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraaqaagedpka fvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyygeyeglycvscerfyteke lveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdlirpegyrnevlamlaepigdlsisrpk srvpwgiplpwdenhvtyvwfdallnyvsaldypegeayrtfwphawhligkdilkphavfwptmlkaa gipmyrhlnvggfllgpdgrkmsktlgnvvdpfallekygrdalryyllreipygqdtpvseealrtry eadladdlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeamayvkal nryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralglkeevrleeaerwgl aeprpipeeapvlfpkkeakveakpkeeawigiedfakvelrvaevlaaekhpnadrllvlrlslgnee rtvvsgiakwyrpeelvgkkvvlvanlkpaklrgiesqgmilaaqegealalvtvegevppgavvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.242
    Matthews' coefficent 2.16 Rfactor 0.195
    Waters 399 Solvent Content 42.97

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch