.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d62

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of multiple sugar binding transport ATP-binding protein. To be Published
    Site RSGI
    PDB Id 2d62 Target Id pho001000194.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13793, Molecular Weight 42509.21 Da.
    Residues 375 Isoelectric Point 6.00
    Sequence migmaevkliniwkrfgdvtavkdlsleikdgeflvllgpsgcgktttlrmiagleeptrgqiyiednl vadpekgvfvppkerdvamvfqsyalyphmtvydniafplklrkvpkqeidkrvrevaemlgltellnr kprelsggqrqrvalgraiirrpkvflmdeplsnldaklrvkmraelkklqrqlgvttiyvthdqveam tmgdriavmnkgelqqvgtpdevyykpvntfvagfigsppmnfldatitddgfldfgefklkllqdqfe vleeenmvgkevifgirpedvhdasfthidvpeentvkatvdiienlggekivhlrrgnisftakfpke skvregdevsvvfdmkkihifrkdtekaif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.214
    Matthews' coefficent 4.29 Rfactor 0.198
    Waters 337 Solvent Content 71.31

    Ligand Information
    Ligands SO4 (SULFATE) x 7;POP (PYROPHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch