.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d69

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the complex of sulfate ion and octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal). To be Published
    Site RSGI
    PDB Id 2d69 Target Id pho001000939.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13951, Molecular Weight 48244.20 Da.
    Residues 430 Isoelectric Point 6.35
    Sequence mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrsm akvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppyeylrhfkgpqf gvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkddenftsfpfnrfeervrkly rvrdrveaetgetkeylinitgpvnimekraemvaneggqyvmidivvagwsalqymrevtedlglaih ahramhaaftrnprhgitmlalakaarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfp vasgglhpglmpelirlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkk slrevglskakvgvqh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.20922
    Matthews' coefficent 2.89 Rfactor 0.17973
    Waters 750 Solvent Content 57.51

    Ligand Information
    Ligands SO4 (SULFATE) x 19
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch