.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d6c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure and peroxidase activity of myoglobin reconstituted with iron porphycene. Inorg.Chem. 45 10530-10536 2006
    Site RSGI
    PDB Id 2d6c Target Id my_001000022.3
    Molecular Characteristics
    Source Physeter catodon
    Alias Ids TPS13690, Molecular Weight 17330.21 Da.
    Residues 154 Isoelectric Point 8.70
    Sequence mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtv ltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalel frkdiaakykelgyqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.26 Rfree 0.295
    Matthews' coefficent 2.52 Rfactor 0.251
    Waters 225 Solvent Content 51.09

    Ligand Information
    Ligands HME-IMD (PORPHYCENE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch