.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d8a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PH0655 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2d8a Target Id pho001000655.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13845, Molecular Weight 37783.74 Da.
    Residues 348 Isoelectric Point 5.52
    Sequence msekmvaimktkpgygaelvevdvpkpgpgevlikvlatsicgtdlhiyewnewaqsrikppqimghev agevveigpgvegievgdyvsvethivcgkcyacrrgqyhvcqntkifgvdtdgvfaeyavvpaqniwk npksippeyatlqeplgnavdtvlagpisgksvlitgagplgllgiavakasgaypvivsepsdfrrel akkvgadyvinpfeedvvkevmditdgngvdvflefsgapkaleqglqavtpagrvsllglypgkvtid fnnliifkaltiygitgrhlwetwytvsrllqsgklnldpiithkykgfdkyeeafelmragktgkvvfmlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.235
    Matthews' coefficent 3.05 Rfactor 0.204
    Waters 263 Solvent Content 59.67

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1
    Metals ZN (ZINC) x 5

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch