The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Chorismate Mutase from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2d8d Target Id ttk003000001.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14145, Molecular Weight 40052.00 Da.
    Residues 355 Isoelectric Point 7.05
    Sequence mderiqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenpgpfpdet irklfkeifkasldleerqdqkkflyskrhkpeptrvrvkdvvfgekplliagpcsieseeqimatarf laargvrvlrggafkprtspygfqglgveglklgrkaadafgmvfvtevmdtrdvevvaeyadilqiga rnmqnfallkevgkarrpvllkrglsatmeewfyaaeyilaqgneqvilaergirtferwtrntldlsa valakqethlpvvvdvthaagrtdllaplaraalavgadgvhvevhpnpkvalsdnqqqmdfaqfdrfl eairdllqap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.15 Rfree 0.219
    Matthews' coefficent 1.86 Rfactor 0.213
    Waters 329 Solvent Content 33.77

    Ligand Information
    Metals CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch