.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d8e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Chorismate Mutase from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2d8e Target Id ttk003000001.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14146, Molecular Weight 40052.00 Da.
    Residues 355 Isoelectric Point 7.05
    Sequence mderiqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenpgpfpdet irklfkeifkasldleerqdqkkflyskrhkpeptrvrvkdvvfgekplliagpcsieseeqimatarf laargvrvlrggafkprtspygfqglgveglklgrkaadafgmvfvtevmdtrdvevvaeyadilqiga rnmqnfallkevgkarrpvllkrglsatmeewfyaaeyilaqgneqvilaergirtferwtrntldlsa valakqethlpvvvdvthaagrtdllaplaraalavgadgvhvevhpnpkvalsdnqqqmdfaqfdrfl eairdllqap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.242
    Matthews' coefficent 1.79 Rfactor 0.225
    Waters 70 Solvent Content 31.36

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch