.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d9a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of RSGI RUH-050, a myb DNA-binding domain in mouse cDNA. To be Published
    Site RSGI
    PDB Id 2d9a Target Id mmt008000525.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13626, Molecular Weight 5916.44 Da.
    Residues 47 Isoelectric Point 9.11
    Sequence kvkwtheedeqlralvrqfgqqdwkflashfpnrtdqqcqyrwlrvl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch