.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dal

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Novel Identified UBA-like Domain in the N-terminal of Human Fas Associated Factor 1 Protein. To be Published
    Site RSGI
    PDB Id 2dal Target Id hsk002000776.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12609, Molecular Weight 4959.34 Da.
    Residues 49 Isoelectric Point 4.83
    Sequence gsaassalkgliqqfttitgasesvgkhmleacnnnlemavtmfldggg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch