.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dar

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of first LIM domain of Enigma-like PDZ and LIM domains protein. To be Published
    Site RSGI
    PDB Id 2dar Target Id hsi002005919.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12407, Molecular Weight 8763.66 Da.
    Residues 77 Isoelectric Point 6.45
    Sequence dqdtlvqraehipagkrtpmcahcnqvirgpflvalgkswhpeefncahckntmayigfveekgalyce lcyekffa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch